PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00040.1.g00310.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 594aa    MW: 64478.1 Da    PI: 10.989
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00040.1.g00310.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.88.5e-37259313559
                        zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                                    l+cprC s+ntkfCy+nny+++qPr+fCk C+ryWt+GGalrnvPvG+grrkn+
  Zjn_sc00040.1.g00310.1.am.mk 259 PLPCPRCRSRNTKFCYFNNYNVNQPRHFCKDCHRYWTAGGALRNVPVGAGRRKNR 313
                                   679**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.733260314IPR003851Zinc finger, Dof-type
PfamPF027014.4E-30260313IPR003851Zinc finger, Dof-type
PROSITE patternPS013610262298IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-19269313IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MWPKGLKTPQ AGVRGCQRRS GSRHARMTRP HPFAFPQQQR NHTASLATVP YKNGEILLES  60
QTPHAPPPQL IIINIREAEP RREPPRPLPI VTPKSSSQRA AEEKKPQLAA YRVRSLSSRG  120
PTHRLSFGSC RLLQPPAAFL AWKVRMLSHV EMAPAAGGFK LFGKVITQCA APAPPPEEPA  180
SRAAAFVRER ADPDESDQPT VKREACVDHD FEKQQQQQQD QGVGGGGTES GESKAAHPRS  240
RQQDTAEARA AAAASSAPPL PCPRCRSRNT KFCYFNNYNV NQPRHFCKDC HRYWTAGGAL  300
RNVPVGAGRR KNRPLGPVVA AVPGHHHQLQ RHRAAAAAGF VLGFPGNPTS PTSPVCADRW  360
PVCPDRRRVR ASSVSRLERV PMNECAPGSR SHESVPVSSL GLTTSPKGMG RTNKLRPHLF  420
WEMIPNLDEW DDFAFAFGGI ETGHLAEQLL LSTHQCAAKG GRGHCRKKRR GVNIPNRQVA  480
RVISSFAPAT VGAESRQPRA LVVGSCAASA GTEGTFWCCT LGSLLDAGLQ DATDTEQAAR  540
TVTWVGSAAC DFMSAAIMSG NAAAAAVLPL RTERGRENRG GSGTAFPRQR RKRT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269984e-87KJ726998.1 Zea mays clone pUT3970 C2C2-DOF transcription factor (DOF37) gene, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.11e-27Dof family protein